General Information

  • ID:  hor002371
  • Uniprot ID:  Q8WMJ4
  • Protein name:  Neurexophilin-3
  • Gene name:  NXPH3
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  Neurexophilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NATGQGNISISLVPPSKAVEXHQXQQIFIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFKVVCVYIAFYSTDYR
  • Length:  95
  • Propeptide:  NATGQGNISISLVPPSKAVEXHQXQQIFIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFKVVCVYIAFYSTDYR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T1 N-linked (GlcNAc...) asparagine;T7 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  May be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99P87-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q99P87-F1.pdbhor002371_AF2.pdbhor002371_ESM.pdb

Physical Information

Mass: 1240076 Formula: C461H716N134O136S6
Absent amino acids: Common amino acids: S
pI: 8.76 Basic residues: 15
Polar residues: 30 Hydrophobic residues: 29
Hydrophobicity: -42.95 Boman Index: -18969
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 63.68
Instability Index: 4527.47 Extinction Coefficient cystines: 15720
Absorbance 280nm: 167.23

Literature

  • PubMed ID:  NA
  • Title:  NA